Lineage for d1y4ta_ (1y4t A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) 
Protein Ferric-binding protein FbpA [53867] (7 species) 
Species Campylobacter jejuni [TaxId:197] [117744] (2 PDB entries)
Uniprot Q9PIV4 17-334
Domain d1y4ta_: 1y4t A: [116464]
complexed with fe
Details for d1y4ta_
PDB Entry: 1y4t (more details), 1.8 Å
PDB Description: Ferric binding protein from Campylobacter jejuni
PDB Compounds: (A:) putative iron-uptake ABC transport system periplasmic iron-binding proteinSCOPe Domain Sequences for d1y4ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]}
selniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadi
snlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkn
yedlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrd
qarqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamt
kssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvski
aenikeavkiydevgfr
SCOPe Domain Coordinates for d1y4ta_:
Click to download the PDB-style file with coordinates for d1y4ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y4ta_:
- d1y4ta_ first appeared in SCOP 1.71
- d1y4ta_ appears in SCOPe 2.05
- d1y4ta_ appears in SCOPe 2.07
- d1y4ta_ appears in the current release, SCOPe 2.08
View in 3D
