![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
![]() | Protein Hypothetical protein YxaG [141597] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141598] (1 PDB entry) Uniprot P42106 5-334 |
![]() | Domain d1y3ta1: 1y3t A:5-334 [122600] complexed with fe |
PDB Entry: 1y3t (more details), 2.4 Å
SCOPe Domain Sequences for d1y3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd pyeghifpckpqalrfdrilqniealdlkv
Timeline for d1y3ta1: