Lineage for d1y3ta1 (1y3t A:5-334)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins)
Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
Protein Hypothetical protein YxaG [141597] (1 species) Species Bacillus subtilis [TaxId:1423] [141598] (1 PDB entry)
Uniprot P42106 5-334
Domain d1y3ta1: 1y3t A:5-334 [122600]
complexed with fe
Details for d1y3ta1
PDB Entry: 1y3t (more details), 2.4 Å
PDB Description: Crystal structure of YxaG, a dioxygenase from Bacillus subtilis
PDB Compounds: (A:) Hypothetical protein yxaGSCOPe Domain Sequences for d1y3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}
cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
pyeghifpckpqalrfdrilqniealdlkv
SCOPe Domain Coordinates for d1y3ta1:
Click to download the PDB-style file with coordinates for d1y3ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y3ta1:
- d1y3ta1 first appeared in SCOP 1.73
- d1y3ta1 appears in SCOPe 2.01
- d1y3ta1 appears in SCOPe 2.03
- d1y3ta1 appears in the current release, SCOPe 2.08
View in 3D
