Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.5: YbjQ-like [117782] (2 families) pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
Family d.230.5.1: YbjQ-like [117783] (3 proteins) Pfam PF01906; DUF 74, UPF0145 |
Protein Hypothetical protein YbjQ [117784] (1 species) |
Species Shigella flexneri [TaxId:623] [117785] (1 PDB entry) Uniprot Q83LS2 |
Domain d1y2ia_: 1y2i A: [116401] Structural genomics target |
PDB Entry: 1y2i (more details), 2.3 Å
SCOPe Domain Sequences for d1y2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2ia_ d.230.5.1 (A:) Hypothetical protein YbjQ {Shigella flexneri [TaxId: 623]} mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
Timeline for d1y2ia_:
View in 3D Domains from other chains: (mouse over for more information) d1y2ib_, d1y2ic_, d1y2id_, d1y2ie_ |