Lineage for d1y0ma_ (1y0m A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054094Protein automated matches [190043] (6 species)
    not a true protein
  7. 2054167Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (8 PDB entries)
  8. 2054169Domain d1y0ma_: 1y0m A: [162125]
    automated match to d1hsqa_

Details for d1y0ma_

PDB Entry: 1y0m (more details), 1.2 Å

PDB Description: crystal structure of of the sh3 domain of phospholipase c gamma-1
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1

SCOPe Domain Sequences for d1y0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ma_ b.34.2.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyveemi
n

SCOPe Domain Coordinates for d1y0ma_:

Click to download the PDB-style file with coordinates for d1y0ma_.
(The format of our PDB-style files is described here.)

Timeline for d1y0ma_: