Lineage for d1y0ba1 (1y0b A:1-191)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610777Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1610778Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1610779Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1611053Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 1611054Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
    Uniprot P42085 1-191
  8. 1611055Domain d1y0ba1: 1y0b A:1-191 [122476]
    complexed with g4p, na

Details for d1y0ba1

PDB Entry: 1y0b (more details), 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.
PDB Compounds: (A:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1y0ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvqe

SCOPe Domain Coordinates for d1y0ba1:

Click to download the PDB-style file with coordinates for d1y0ba1.
(The format of our PDB-style files is described here.)

Timeline for d1y0ba1: