Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins) |
Protein automated matches [190114] (2 species) not a true protein |
Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries) |
Domain d1xyia_: 1xyi A: [162124] automated match to d1azpa_ protein/DNA complex; mutant |
PDB Entry: 1xyi (more details), 1.45 Å
SCOPe Domain Sequences for d1xyia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyia_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]} mvkvkfkykgeekevdtskikkvwragkavsftyddngktgrgavsekdapkelldmlar aerekk
Timeline for d1xyia_: