Lineage for d1xyga1 (1xyg A:15-162,A:327-359)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries)
    Uniprot O82187 15-359
  8. Domain d1xyga1: 1xyg A:15-162,A:327-359 [116221]
    Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2

Details for d1xyga1

PDB Entry: 1xyg (more details), 2.19 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g19940
PDB Compounds: (A:) putative N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1xyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyga1 c.2.1.3 (A:15-162,A:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp

SCOPe Domain Coordinates for d1xyga1 are not available.

Timeline for d1xyga1:

Domains from same chain:
(mouse over for more information)
d1xyga2
Domains from other chains:
(mouse over for more information)
d1xygb1, d1xygb2, d1xygc1, d1xygc2, d1xygd1, d1xygd2