Lineage for d1xy7a_ (1xy7 A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) 
Family d.32.1.9: Hypothetical protein At5g48480 [117876] (1 protein)
subunit fold and dimeric assembly are similar to those of glyoxalaseProtein Hypothetical protein At5g48480 [117877] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117878] (2 PDB entries) 
Domain d1xy7a_: 1xy7 A: [116215]
Details for d1xy7a_
PDB Entry: 1xy7 (more details), 1.8 Å
PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g48480
PDB Compounds: (A:) unknown proteinSCOP Domain Sequences for d1xy7a_:
Sequence, based on SEQRES records: (download)
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlag
ssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfk
gkvtdpfgvtwifae
Sequence, based on observed residues (ATOM records): (download)
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs
taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae
SCOP Domain Coordinates for d1xy7a_:
Click to download the PDB-style file with coordinates for d1xy7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xy7a_:
- d1xy7a_ first appeared in SCOP 1.71
- d1xy7a_ appears in SCOP 1.75
- d1xy7a_ appears in the current release, SCOPe 2.08
View in 3D
