![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class mu GST [81348] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries) Uniprot P09488 P28161 |
![]() | Domain d1xw6a1: 1xw6 A:85-217 [116103] Other proteins in same PDB: d1xw6a2, d1xw6b2, d1xw6c2, d1xw6d2 complexed with gsh |
PDB Entry: 1xw6 (more details), 1.9 Å
SCOPe Domain Sequences for d1xw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xw6a1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp rpvfskmavwgnk
Timeline for d1xw6a1: