Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) characteristic metal ion (zinc)-binding motif in the putative active site |
Family d.290.1.1: Alpha-acetolactate decarboxylase-like [117857] (1 protein) Pfam PF03306 |
Protein Hypothetical protein SA2394 [117858] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [117859] (1 PDB entry) Uniprot Q7A3A7 |
Domain d1xv2c_: 1xv2 C: [116078] Structural genomics target complexed with zn |
PDB Entry: 1xv2 (more details), 2 Å
SCOPe Domain Sequences for d1xv2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xv2c_ d.290.1.1 (C:) Hypothetical protein SA2394 {Staphylococcus aureus [TaxId: 1280]} tnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehke fielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhm hvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfadder aygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
Timeline for d1xv2c_: