Lineage for d1xu9b_ (1xu9 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1826950Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1826966Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
    Uniprot P28845
  8. 1826968Domain d1xu9b_: 1xu9 B: [116053]
    complexed with cps, mes, ndp

Details for d1xu9b_

PDB Entry: 1xu9 (more details), 1.55 Å

PDB Description: crystal structure of the interface closed conformation of 11b- hydroxysteroid dehydrogenase isozyme 1
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1xu9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu9b_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
eysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyd
sslwttllirnpsrkileflystsynmdrf

SCOPe Domain Coordinates for d1xu9b_:

Click to download the PDB-style file with coordinates for d1xu9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xu9b_: