| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein GTP-binding protein RheB [142275] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142276] (2 PDB entries) Uniprot Q15382 3-169 |
| Domain d1xtqa1: 1xtq A:3-169 [122297] complexed with gdp, mg |
PDB Entry: 1xtq (more details), 2 Å
SCOPe Domain Sequences for d1xtqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek
Timeline for d1xtqa1: