Lineage for d1xtia1 (1xti A:46-254)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
duplication: tandem repeat of two RecA-like (AAA) domains
Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
Uniprot Q13838 45-428
Domain d1xtia1: 1xti A:46-254 [116022]
complexed with ipa
Details for d1xtia1
PDB Entry: 1xti (more details), 1.95 Å
PDB Description: Structure of Wildtype human UAP56
PDB Compounds: (A:) Probable ATP-dependent RNA helicase p47SCOPe Domain Sequences for d1xtia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtia1 c.37.1.19 (A:46-254) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
gfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatlq
qlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkknc
phivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqvm
mfsatlskeirpvcrkfmqdpmeifvdde
SCOPe Domain Coordinates for d1xtia1:
Click to download the PDB-style file with coordinates for d1xtia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xtia1:
- d1xtia1 first appeared in SCOP 1.71
- d1xtia1 appears in SCOPe 2.04
- d1xtia1 appears in SCOPe 2.06
- d1xtia1 appears in the current release, SCOPe 2.08
View in 3D
