Lineage for d1xt9a_ (1xt9 A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.7: Adenain-like [54054] (6 proteins)
Pfam PF02902; Ulp1 protease family
Protein Sentrin-specific protease 8, SENP8 [117760] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117761] (2 PDB entries)
Uniprot Q96LD8
Domain d1xt9a_: 1xt9 A: [116013]
Other proteins in same PDB: d1xt9b_
Details for d1xt9a_
PDB Entry: 1xt9 (more details), 2.2 Å
PDB Description: Crystal Structure of Den1 in complex with Nedd8
PDB Compounds: (A:) Sentrin-specific protease 8SCOPe Domain Sequences for d1xt9a_:
Sequence, based on SEQRES records: (download)
>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdlittlak
Sequence, based on observed residues (ATOM records): (download)
>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
ikctsneiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydshsr
snsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrqqt
esllqlltpayitkkrgewkdlittlak
SCOPe Domain Coordinates for d1xt9a_:
Click to download the PDB-style file with coordinates for d1xt9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xt9a_:
- d1xt9a_ first appeared in SCOP 1.71
- d1xt9a_ appears in SCOP 1.75
- d1xt9a_ appears in SCOPe 2.02
- d1xt9a_ appears in the current release, SCOPe 2.08
View in 3D
