Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
Protein Sentrin-specific protease 8, SENP8 [117760] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117761] (2 PDB entries) Uniprot Q96LD8 |
Domain d1xt9a_: 1xt9 A: [116013] Other proteins in same PDB: d1xt9b_ |
PDB Entry: 1xt9 (more details), 2.2 Å
SCOPe Domain Sequences for d1xt9a_:
Sequence, based on SEQRES records: (download)
>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]} dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydsh srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq qtesllqlltpayitkkrgewkdlittlak
>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]} dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf ikctsneiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydshsr snsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrqqt esllqlltpayitkkrgewkdlittlak
Timeline for d1xt9a_: