Lineage for d1xt8b_ (1xt8 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162963Protein Putative amino-acid transporter CjaA [142814] (1 species)
  7. 2162964Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry)
    Uniprot Q0P9S0 29-276
  8. 2162966Domain d1xt8b_: 1xt8 B: [122294]
    automated match to d1xt8a1
    complexed with cys, gol

Details for d1xt8b_

PDB Entry: 1xt8 (more details), 2 Å

PDB Description: crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution
PDB Compounds: (B:) putative amino-acid transporter periplasmic solute-binding protein

SCOPe Domain Sequences for d1xt8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xt8b_ c.94.1.1 (B:) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}
sktlnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqf
vlveaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsved
lkdktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvk
dhpdfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgd
dvkaddvvieg

SCOPe Domain Coordinates for d1xt8b_:

Click to download the PDB-style file with coordinates for d1xt8b_.
(The format of our PDB-style files is described here.)

Timeline for d1xt8b_: