Lineage for d1xssb_ (1xss B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.0: automated matches [191400] (1 protein)
not a true familyProtein automated matches [190526] (17 species)
not a true protein
Species Favia favus [TaxId:102203] [188529] (3 PDB entries) 
Domain d1xssb_: 1xss B: [162104]
automated match to d1mova_
complexed with mg, na
Details for d1xssb_
PDB Entry: 1xss (more details), 1.6 Å
PDB Description: Semi-rational engineering of a green-emitting coral fluorescent protein into an efficient highlighter.
PDB Compounds: (B:) fluorescent proteinSCOPe Domain Sequences for d1xssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xssb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprlak
SCOPe Domain Coordinates for d1xssb_:
Click to download the PDB-style file with coordinates for d1xssb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xssb_:
- d1xssb_ first appeared in SCOPe 2.01
- d1xssb_ appears in SCOPe 2.02
- d1xssb_ appears in SCOPe 2.04
- d1xssb_ appears in the current release, SCOPe 2.08
View in 3D
