Lineage for d1xs5a_ (1xs5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162971Protein Putative lipoprotein (NlpA family) [102700] (2 species)
    aka PG110, TpN32
  7. 2162974Species Treponema pallidum [TaxId:160] [117746] (1 PDB entry)
    Uniprot O07950 28-267
  8. 2162975Domain d1xs5a_: 1xs5 A: [115912]
    Structural genomics target
    complexed with met

Details for d1xs5a_

PDB Entry: 1xs5 (more details), 1.85 Å

PDB Description: The Crystal Structure of Lipoprotein Tp32 from Treponema pallidum
PDB Compounds: (A:) Membrane lipoprotein TpN32

SCOPe Domain Sequences for d1xs5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]}
kdetvgvgvlsepharlleiakeevkkqhielriveftnyvalneavmrgdilmnffqhv
phmqqfnqehngdlvsvgnvhveplalysrtyrhvsdfpagaviaipndssnearalrll
eaagfirmragsglfatvedvqqnvrnvvlqevesallprvfdqvdgavingnyaimagl
sarrdglavepdasayanvlvvkrgneadarvqavlralcggrvrtylkerykggevapa

SCOPe Domain Coordinates for d1xs5a_:

Click to download the PDB-style file with coordinates for d1xs5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xs5a_: