| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein Putative lipoprotein (NlpA family) [102700] (2 species) aka PG110, TpN32 |
| Species Treponema pallidum [TaxId:160] [117746] (1 PDB entry) Uniprot O07950 28-267 |
| Domain d1xs5a_: 1xs5 A: [115912] Structural genomics target complexed with met |
PDB Entry: 1xs5 (more details), 1.85 Å
SCOPe Domain Sequences for d1xs5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]}
kdetvgvgvlsepharlleiakeevkkqhielriveftnyvalneavmrgdilmnffqhv
phmqqfnqehngdlvsvgnvhveplalysrtyrhvsdfpagaviaipndssnearalrll
eaagfirmragsglfatvedvqqnvrnvvlqevesallprvfdqvdgavingnyaimagl
sarrdglavepdasayanvlvvkrgneadarvqavlralcggrvrtylkerykggevapa
Timeline for d1xs5a_: