Lineage for d1xrha_ (1xrh A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885251Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 1885252Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 1885253Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 1885276Protein Ureidoglycolate dehydrogenase AllD [117675] (1 species)
  7. 1885277Species Escherichia coli [TaxId:562] [117676] (1 PDB entry)
    Uniprot P77555
  8. 1885278Domain d1xrha_: 1xrh A: [115871]

Details for d1xrha_

PDB Entry: 1xrh (more details), 2.25 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase from escherichia coli
PDB Compounds: (A:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d1xrha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrha_ c.122.1.1 (A:) Ureidoglycolate dehydrogenase AllD {Escherichia coli [TaxId: 562]}
sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
nqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye

SCOPe Domain Coordinates for d1xrha_:

Click to download the PDB-style file with coordinates for d1xrha_.
(The format of our PDB-style files is described here.)

Timeline for d1xrha_: