Lineage for d1xq5b_ (1xq5 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759496Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 759503Domain d1xq5b_: 1xq5 B: [115826]
    Other proteins in same PDB: d1xq5a_, d1xq5c_
    Structural genomics target

Details for d1xq5b_

PDB Entry: 1xq5 (more details), 1.9 Å

PDB Description: Met-Perch Hemoglobin at 1.9A
PDB Compounds: (B:) Hemoglobin beta-2 chain

SCOP Domain Sequences for d1xq5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOP Domain Coordinates for d1xq5b_:

Click to download the PDB-style file with coordinates for d1xq5b_.
(The format of our PDB-style files is described here.)

Timeline for d1xq5b_: