Lineage for d1xq4a_ (1xq4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766701Superfamily b.1.23: ApaG-like [110069] (2 families) (S)
  5. 2766702Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit
  6. 2766703Protein ApaG [110071] (4 species)
  7. 2766704Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry)
    Uniprot Q7VU61
  8. 2766705Domain d1xq4a_: 1xq4 A: [115821]
    Structural genomics target
    complexed with po4

Details for d1xq4a_

PDB Entry: 1xq4 (more details), 2.7 Å

PDB Description: crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40
PDB Compounds: (A:) Protein apaG

SCOPe Domain Sequences for d1xq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]}
pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
prt

SCOPe Domain Coordinates for d1xq4a_:

Click to download the PDB-style file with coordinates for d1xq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xq4a_: