Lineage for d1xq1a_ (1xq1 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 976375Protein Tropinone reductase [51795] (3 species)
  7. 976387Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117410] (1 PDB entry)
    Uniprot Q9ASX2
  8. 976388Domain d1xq1a_: 1xq1 A: [115818]
    Structural genomics target

Details for d1xq1a_

PDB Entry: 1xq1 (more details), 2.1 Å

PDB Description: x-ray structure of putative tropinone reducatse from arabidopsis thaliana gene at1g07440
PDB Compounds: (A:) putative tropinone reducatse

SCOPe Domain Sequences for d1xq1a_:

Sequence, based on SEQRES records: (download)

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
gsvcdaslrpereklmqtvssmfggkldilinnlgairskptldytaedfsfhistnles
ayhlsqlahpllkasgcgniifmssiagvvsasvgsiysatkgalnqlarnlacewasdg
iranavapaviatplaeavyddefkkvvisrkplgrfgepeevsslvaflcmpaasyitg
qticvdggltvngfsyqpq

Sequence, based on observed residues (ATOM records): (download)

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
gsvcdaslrpereklmqtvssmfggkldilinnlgaldytaedfsfhistnlesayhlsq
lahpllkasgcgniifmsgsiysatkgalnqlarnlacewasdgiranavapaviagepe
evsslvaflcmpaasyitgqticvdggltvngfsyqpq

SCOPe Domain Coordinates for d1xq1a_:

Click to download the PDB-style file with coordinates for d1xq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1xq1a_: