Lineage for d1xp3a1 (1xp3 A:2-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839045Family c.1.15.1: Endonuclease IV [51659] (2 proteins)
  6. 2839046Protein Endonuclease IV [51660] (2 species)
    DNA repair enzyme
  7. 2839047Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141851] (1 PDB entry)
    Uniprot Q81LV1 2-298
  8. 2839048Domain d1xp3a1: 1xp3 A:2-298 [122210]
    complexed with so4, zn

Details for d1xp3a1

PDB Entry: 1xp3 (more details), 2.57 Å

PDB Description: Crystal Structure of Endonuclease IV (BA4508) from Bacillus anthracis at 2.57A Resolution.
PDB Compounds: (A:) endonuclease IV

SCOPe Domain Sequences for d1xp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lkigshvsmsgkkmllaaseeavsygattfmiytgapqntrrkpieelnieagrkhmeqn
gieeiiihapyiinvgnttkpetfqlgvdflrmeiertsalgvakqivlhpgahvgagad
agiqqiikglnevltpdqtvnialetmagkgtecgrsfeeiakiidgvkyneklsvcfdt
chthdagydivnnfdgvlnefdkivgidrlqvlhindsknvrgagkdrhenigfghigyk
alhhivhhpqlthvpkiletpyvgedkkdkkppykleiemlkngtfdegllekikaq

SCOPe Domain Coordinates for d1xp3a1:

Click to download the PDB-style file with coordinates for d1xp3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xp3a1: