Class g: Small proteins [56992] (90 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) |
Domain d1xoxa1: 1xox A:7-117 [122208] automatically matched to d1m4ma_ complexed with zn |
PDB Entry: 1xox (more details)
SCOPe Domain Sequences for d1xoxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xoxa1 g.52.1.1 (A:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
Timeline for d1xoxa1: