Lineage for d1xoda1 (1xod A:10-123)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323726Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 1323753Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)
  7. 1323756Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [141431] (2 PDB entries)
    Uniprot Q66JG9 10-123! Uniprot Q66JG9 9-123
  8. 1323757Domain d1xoda1: 1xod A:10-123 [122202]
    Other proteins in same PDB: d1xodb_
    complexed with gol

Details for d1xoda1

PDB Entry: 1xod (more details), 1.15 Å

PDB Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain
PDB Compounds: (A:) Spred1

SCOPe Domain Sequences for d1xoda1:

Sequence, based on SEQRES records: (download)

>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
syarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvvl
ecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Sequence, based on observed residues (ATOM records): (download)

>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
syarvravvmtrddssggwlqlgggglssvtvsktteflvhgerlrdktvvlecvlrrdl
vynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

SCOPe Domain Coordinates for d1xoda1:

Click to download the PDB-style file with coordinates for d1xoda1.
(The format of our PDB-style files is described here.)

Timeline for d1xoda1: