Lineage for d1xo3a_ (1xo3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1893977Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 1894020Family d.15.3.3: C9orf74 homolog [117833] (1 protein)
    automatically mapped to Pfam PF09138
  6. 1894021Protein C9orf74 homolog [117834] (1 species)
  7. 1894022Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries)
    Uniprot Q9D2P4 #
  8. 1894024Domain d1xo3a_: 1xo3 A: [115678]
    Structural genomics target

Details for d1xo3a_

PDB Entry: 1xo3 (more details)

PDB Description: solution structure of ubiquitin like protein from mus musculus
PDB Compounds: (A:) RIKEN cDNA 2900073H19

SCOPe Domain Sequences for d1xo3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]}
saaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqg
dsvrpgilvlindadwellgeldyqlqdqdsilfistlhgg

SCOPe Domain Coordinates for d1xo3a_:

Click to download the PDB-style file with coordinates for d1xo3a_.
(The format of our PDB-style files is described here.)

Timeline for d1xo3a_: