Lineage for d1xl4a2 (1xl4 A:23-138)
- Root: SCOPe 2.03
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
oligomeric transmembrane alpha-helical proteinsSuperfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) 
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) 
Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species) Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
Domain d1xl4a2: 1xl4 A:23-138 [115431]
Other proteins in same PDB: d1xl4a1, d1xl4b1
complexed with k, mg
Details for d1xl4a2
PDB Entry: 1xl4 (more details), 2.6 Å
PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channelSCOPe Domain Sequences for d1xl4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp
SCOPe Domain Coordinates for d1xl4a2:
Click to download the PDB-style file with coordinates for d1xl4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xl4a2:
- d1xl4a2 first appeared in SCOP 1.71
- d1xl4a2 appears in SCOPe 2.02
- d1xl4a2 appears in SCOPe 2.04
- d1xl4a2 appears in the current release, SCOPe 2.08
View in 3D
