Lineage for d1xl3a1 (1xl3 A:78-283)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928494Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 928495Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 928505Family a.243.1.3: LcrE-like [140598] (1 protein)
    Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain
  6. 928506Protein Outer membrane protein yopN (LcrE) [140599] (1 species)
  7. 928507Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
    Uniprot P68640 73-269! Uniprot P68640 78-283
  8. 928509Domain d1xl3a1: 1xl3 A:78-283 [122102]
    Other proteins in same PDB: d1xl3c1, d1xl3d1

Details for d1xl3a1

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (A:) Secretion control protein

SCOPe Domain Sequences for d1xl3a1:

Sequence, based on SEQRES records: (download)

>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

Sequence, based on observed residues (ATOM records): (download)

>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeqnvsellsllsnspnislsqlkaylegkseepseqfkmlcg
lrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqplrdt
yrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgivisd
lqklkefgsvsdqvkgfwqffs

SCOPe Domain Coordinates for d1xl3a1:

Click to download the PDB-style file with coordinates for d1xl3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xl3a1: