Class a: All alpha proteins [46456] (284 folds) |
Fold a.243: Type III secretion system domain [140590] (1 superfamily) core: 4 helices, orthogonal array; right-handed superhelix |
Superfamily a.243.1: Type III secretion system domain [140591] (3 families) |
Family a.243.1.3: LcrE-like [140598] (1 protein) Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain |
Protein Outer membrane protein yopN (LcrE) [140599] (1 species) |
Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries) Uniprot P68640 73-269! Uniprot P68640 78-283 |
Domain d1xl3a1: 1xl3 A:78-283 [122102] Other proteins in same PDB: d1xl3c1, d1xl3d1 |
PDB Entry: 1xl3 (more details), 2.2 Å
SCOPe Domain Sequences for d1xl3a1:
Sequence, based on SEQRES records: (download)
>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]} arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi visdlqklkefgsvsdqvkgfwqffs
>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]} arvsdveeqvnqylskvpeqnvsellsllsnspnislsqlkaylegkseepseqfkmlcg lrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqplrdt yrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgivisd lqklkefgsvsdqvkgfwqffs
Timeline for d1xl3a1: