Lineage for d1xkya1 (1xky A:1-292)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342288Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 1342289Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141832] (2 PDB entries)
    Uniprot Q81WN7 1-292
  8. 1342290Domain d1xkya1: 1xky A:1-292 [122094]
    complexed with k

Details for d1xkya1

PDB Entry: 1xky (more details), 1.94 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis at 1.94A Resolution.
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1xkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

SCOPe Domain Coordinates for d1xkya1:

Click to download the PDB-style file with coordinates for d1xkya1.
(The format of our PDB-style files is described here.)

Timeline for d1xkya1: