SCOPe 2.05: Domain d1xhxa2: 1xhx A:188-575

Lineage for d1xhxa2 (1xhx A:188-575)

Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
"palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
Protein phi29 DNA polymerase [118193] (1 species)
Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
Uniprot P03680
Domain d1xhxa2: 1xhx A:188-575 [115306]
Other proteins in same PDB: d1xhxa1, d1xhxb1, d1xhxc1, d1xhxd1
complexed with mg, so4

Details for d1xhxa2

PDB Entry: 1xhx (more details), 2.35 Å

PDB Description: phi29 dna polymerase, orthorhombic crystal form

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1xhxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhxa2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d1xhxa2:

Click to download the PDB-style file with coordinates for d1xhxa2.
(The format of our PDB-style files is described here.)

Timeline for d1xhxa2: