Lineage for d1xhxa2 (1xhx A:188-575)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein phi29 DNA polymerase [118193] (1 species)
  7. Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. Domain d1xhxa2: 1xhx A:188-575 [115306]
    Other proteins in same PDB: d1xhxa1, d1xhxb1, d1xhxc1, d1xhxd1
    complexed with mg, so4

Details for d1xhxa2

PDB Entry: 1xhx (more details), 2.35 Å

PDB Description: Phi29 DNA Polymerase, orthorhombic crystal form
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1xhxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhxa2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d1xhxa2 are not available.

Timeline for d1xhxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xhxb1, d1xhxb2, d1xhxc1, d1xhxc2, d1xhxd1, d1xhxd2