Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein phi29 DNA polymerase [118193] (1 species) |
Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries) Uniprot P03680 |
Domain d1xhxa2: 1xhx A:188-575 [115306] Other proteins in same PDB: d1xhxa1, d1xhxb1, d1xhxc1, d1xhxd1 complexed with mg, so4 |
PDB Entry: 1xhx (more details), 2.35 Å
SCOPe Domain Sequences for d1xhxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhxa2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk vgfsrkmkpkpvqvpggvvlvddtftik
Timeline for d1xhxa2: