SCOPe 2.07: Domain d1xhna1: 1xhn A:13-182

Lineage for d1xhna1 (1xhn A:13-182)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-key
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
related to the ferredoxin reductase-like FAD-binding domain
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
Protein Cellular repressor of E1A-stimulated genes CREG1 [141356] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [141357] (1 PDB entry)
Uniprot O75629 49-218
Domain d1xhna1: 1xhn A:13-182 [122007]
Other proteins in same PDB: d1xhna2, d1xhnb2, d1xhnb3, d1xhnc2, d1xhnc3, d1xhnd2, d1xhnd3

Details for d1xhna1

PDB Entry: 1xhn (more details), 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)

PDB Compounds: (A:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhna1 b.45.1.1 (A:13-182) Cellular repressor of E1A-stimulated genes CREG1 {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

SCOPe Domain Coordinates for d1xhna1:

Click to download the PDB-style file with coordinates for d1xhna1.
(The format of our PDB-style files is described here.)

Timeline for d1xhna1: