Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins) Pfam PF01106 |
Protein Nitrogen fixation protein NifU homolog SE0630 [117920] (1 species) |
Species Staphylococcus epidermidis [TaxId:1282] [117921] (1 PDB entry) Uniprot Q8CPV7 |
Domain d1xhja_: 1xhj A: [115298] Structural genomics target |
PDB Entry: 1xhj (more details)
SCOPe Domain Sequences for d1xhja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]} mptenptmfdqvaevierlrpfllrdggdctlvdvedgivklqlhgacgtcpsstitlka gieralheevpgvieveqvflehhhhhh
Timeline for d1xhja_: