Lineage for d1xhja_ (1xhj A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648684Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1648871Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 1648872Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins)
    Pfam PF01106
  6. 1648879Protein Nitrogen fixation protein NifU homolog SE0630 [117920] (1 species)
  7. 1648880Species Staphylococcus epidermidis [TaxId:1282] [117921] (1 PDB entry)
    Uniprot Q8CPV7
  8. 1648881Domain d1xhja_: 1xhj A: [115298]
    Structural genomics target

Details for d1xhja_

PDB Entry: 1xhj (more details)

PDB Description: Solution Structure Of The Staphylococcus Epidermidis Protein SE0630. Northest Structural Genomics Consortium Target SeR8.
PDB Compounds: (A:) Nitrogen Fixation Protein NifU

SCOPe Domain Sequences for d1xhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]}
mptenptmfdqvaevierlrpfllrdggdctlvdvedgivklqlhgacgtcpsstitlka
gieralheevpgvieveqvflehhhhhh

SCOPe Domain Coordinates for d1xhja_:

Click to download the PDB-style file with coordinates for d1xhja_.
(The format of our PDB-style files is described here.)

Timeline for d1xhja_: