Lineage for d1xhda_ (1xhd A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962730Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 962752Protein Putative acetyltransferase/acyltransferase BC4754 [117308] (1 species)
  7. 962753Species Bacillus cereus [TaxId:1396] [117309] (1 PDB entry)
    Uniprot Q816R4
  8. 962754Domain d1xhda_: 1xhd A: [115295]
    Structural genomics target
    complexed with so4

Details for d1xhda_

PDB Entry: 1xhd (more details), 1.9 Å

PDB Description: X-ray crystal structure of putative acetyltransferase, product of BC4754 gene [Bacillus cereus]
PDB Compounds: (A:) putative acetyltransferase/acyltransferase

SCOPe Domain Sequences for d1xhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}
snamiypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnv
qdqctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigag
slvsqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslq

SCOPe Domain Coordinates for d1xhda_:

Click to download the PDB-style file with coordinates for d1xhda_.
(The format of our PDB-style files is described here.)

Timeline for d1xhda_: