Lineage for d1xgsa2 (1xgs A:1-194,A:272-295)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Methionine aminopeptidase [55924] (7 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. Domain d1xgsa2: 1xgs A:1-194,A:272-295 [41153]
    Other proteins in same PDB: d1xgsa1, d1xgsb1
    complexed with co

Details for d1xgsa2

PDB Entry: 1xgs (more details), 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOPe Domain Coordinates for d1xgsa2 are not available.

Timeline for d1xgsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xgsb1, d1xgsb2