Lineage for d1xgsa1 (1xgs A:195-271)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [46889] (5 PDB entries)
  8. Domain d1xgsa1: 1xgs A:195-271 [16216]
    Other proteins in same PDB: d1xgsa2, d1xgsb2
    complexed with co

Details for d1xgsa1

PDB Entry: 1xgs (more details), 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgsa1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus [TaxId: 2261]}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOPe Domain Coordinates for d1xgsa1 are not available.

Timeline for d1xgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xgsb1, d1xgsb2