| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 proteins) part of Pfam PF00249 (Myb/SANT domain) |
| Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries) Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known (63605) |
| Domain d1xg1a1: 1xg1 A:5-67 [121973] Other proteins in same PDB: d1xg1a2 |
PDB Entry: 1xg1 (more details)
SCOPe Domain Sequences for d1xg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xg1a1 a.4.1.4 (A:5-67) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn
Timeline for d1xg1a1: