Lineage for d1xg1a1 (1xg1 A:5-67)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720765Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 proteins)
    part of Pfam PF00249 (Myb/SANT domain)
  6. 1720773Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)
  7. 1720774Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
    Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known (63605)
  8. 1720777Domain d1xg1a1: 1xg1 A:5-67 [121973]

Details for d1xg1a1

PDB Entry: 1xg1 (more details)

PDB Description: Solution structure of Myb-domain of human TRF2
PDB Compounds: (A:) telomeric repeat binding factor 2

SCOPe Domain Sequences for d1xg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg1a1 a.4.1.4 (A:5-67) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn

SCOPe Domain Coordinates for d1xg1a1:

Click to download the PDB-style file with coordinates for d1xg1a1.
(The format of our PDB-style files is described here.)

Timeline for d1xg1a1: