Lineage for d1xg1a1 (1xg1 A:5-67)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 proteins)
part of Pfam PF00249 (Myb/SANT domain)
Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species) Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known (63605)
Domain d1xg1a1: 1xg1 A:5-67 [121973]
Other proteins in same PDB: d1xg1a2
Details for d1xg1a1
PDB Entry: 1xg1 (more details)
PDB Description: solution structure of myb-domain of human trf2
PDB Compounds: (A:) telomeric repeat binding factor 2SCOPe Domain Sequences for d1xg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xg1a1 a.4.1.4 (A:5-67) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn
SCOPe Domain Coordinates for d1xg1a1:
Click to download the PDB-style file with coordinates for d1xg1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xg1a1:
- d1xg1a1 first appeared in SCOP 1.73
- d1xg1a1 appears in SCOPe 2.07
View in 3D
