Lineage for d1xfla_ (1xfl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2131618Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2131684Protein Thioredoxin [52835] (16 species)
  7. 2131893Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110603] (1 PDB entry)
    Uniprot P29448 #
  8. 2131894Domain d1xfla_: 1xfl A: [109586]
    Structural genomics target

Details for d1xfla_

PDB Entry: 1xfl (more details)

PDB Description: solution structure of thioredoxin h1 from arabidopsis thaliana
PDB Compounds: (A:) Thioredoxin h1

SCOPe Domain Sequences for d1xfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv
lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla

SCOPe Domain Coordinates for d1xfla_:

Click to download the PDB-style file with coordinates for d1xfla_.
(The format of our PDB-style files is described here.)

Timeline for d1xfla_: