Lineage for d1xfha_ (1xfh A:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746717Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
    multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer
  4. 746718Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) (S)
  5. 746719Family f.49.1.1: Proton glutamate symport protein [118216] (1 protein)
  6. 746720Protein Proton glutamate symport protein [118217] (1 species)
  7. 746721Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
  8. 746728Domain d1xfha_: 1xfh A: [115261]

Details for d1xfha_

PDB Entry: 1xfh (more details), 3.5 Å

PDB Description: structure of glutamate transporter homolog from pyrococcus horikoshii
PDB Compounds: (A:) proton glutamate symport protein

SCOP Domain Sequences for d1xfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfha_ f.49.1.1 (A:) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakteg

SCOP Domain Coordinates for d1xfha_:

Click to download the PDB-style file with coordinates for d1xfha_.
(The format of our PDB-style files is described here.)

Timeline for d1xfha_: