Lineage for d1xeya_ (1xey A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
automatically mapped to Pfam PF00282
Protein Glutamate decarboxylase alpha, GadA [117695] (1 species) Species Escherichia coli [TaxId:562] [117696] (1 PDB entry)
Uniprot P69908
Domain d1xeya_: 1xey A: [115237]
complexed with act, gua, plp
Details for d1xeya_
PDB Entry: 1xey (more details), 2.05 Å
PDB Description: Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution
PDB Compounds: (A:) Glutamate decarboxylase alphaSCOPe Domain Sequences for d1xeya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeya_ c.67.1.6 (A:) Glutamate decarboxylase alpha, GadA {Escherichia coli [TaxId: 562]}
klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdh
SCOPe Domain Coordinates for d1xeya_:
Click to download the PDB-style file with coordinates for d1xeya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xeya_:
- d1xeya_ first appeared in SCOP 1.71
- d1xeya_ appears in SCOPe 2.05
- d1xeya_ appears in SCOPe 2.07
- d1xeya_ appears in the current release, SCOPe 2.08
View in 3D
