| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (2 species) |
| Species Influenza B virus [TaxId:11520] [140389] (1 PDB entry) Uniprot P03502 15-103 |
| Domain d1xeqa1: 1xeq A:15-103 [121915] complexed with br |
PDB Entry: 1xeq (more details), 2.1 Å
SCOPe Domain Sequences for d1xeqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeqa1 a.16.1.1 (A:15-103) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]}
gatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepenkrmsl
eerkaigvkmmkvllfmdpsagiegfepy
Timeline for d1xeqa1: