Lineage for d1xeqa1 (1xeq A:15-103)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
3 helices; irregular arraySuperfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) 
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) 
Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species) 
Species Influenza B virus [TaxId:11520] [140389] (4 PDB entries)
Uniprot P03502 15-103
Domain d1xeqa1: 1xeq A:15-103 [121915]
complexed with br
Details for d1xeqa1
PDB Entry: 1xeq (more details), 2.1 Å
PDB Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein
PDB Compounds: (A:) Nonstructural protein NS1SCOPe Domain Sequences for d1xeqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeqa1 a.16.1.1 (A:15-103) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]}
gatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepenkrmsl
eerkaigvkmmkvllfmdpsagiegfepy
SCOPe Domain Coordinates for d1xeqa1:
Click to download the PDB-style file with coordinates for d1xeqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xeqa1:
- d1xeqa1 first appeared in SCOP 1.73
- d1xeqa1 appears in SCOPe 2.07
View in 3D
