Lineage for d1xcga1 (1xcg A:714-941)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496671Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 1496672Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 1496673Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 1496701Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)
  7. 1496702Species Human (Homo sapiens) [TaxId:9606] [116958] (3 PDB entries)
    Uniprot O15085 714-1081
  8. 1496703Domain d1xcga1: 1xcg A:714-941 [115120]
    Other proteins in same PDB: d1xcga2, d1xcgb_, d1xcge2, d1xcgf_

Details for d1xcga1

PDB Entry: 1xcg (more details), 2.5 Å

PDB Description: crystal structure of human rhoa in complex with dh/ph fragment of pdzrhogef
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d1xcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

SCOPe Domain Coordinates for d1xcga1:

Click to download the PDB-style file with coordinates for d1xcga1.
(The format of our PDB-style files is described here.)

Timeline for d1xcga1:

1496703
d1xcga1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1xcga2