Lineage for d1x99a_ (1x99 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
sandwich, 10 strands in 2 sheets;Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) 
some topological similarity to osmotinFamily b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
Pfam PF07367
Protein Lectin xcl [117120] (1 species) Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)
Uniprot Q8WZC9
Domain d1x99a_: 1x99 A: [114978]
complexed with edo, so4
Details for d1x99a_
PDB Entry: 1x99 (more details), 1.4 Å
PDB Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m
PDB Compounds: (A:) lectinSCOPe Domain Sequences for d1x99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x99a_ b.97.1.2 (A:) Lectin xcl {Xerocomus chrysenteron [TaxId: 5386]}
ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
aigtkvevvytvaegnnleanvifs
SCOPe Domain Coordinates for d1x99a_:
Click to download the PDB-style file with coordinates for d1x99a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x99a_:
- d1x99a_ first appeared in SCOP 1.71
- d1x99a_ appears in SCOPe 2.04
- d1x99a_ is called d1x99a1 in SCOPe 2.06
- d1x99a_ appears in the current release, SCOPe 2.08, called d1x99a1
View in 3D
