Lineage for d1x92b_ (1x92 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844652Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 844653Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 844737Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
    dimer of mono-domain subunits
  6. 844753Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 844764Species Pseudomonas aeruginosa [TaxId:287] [117729] (1 PDB entry)
    Uniprot Q9HVZ0
  8. 844766Domain d1x92b_: 1x92 B: [114977]
    complexed with m7p

Details for d1x92b_

PDB Entry: 1x92 (more details), 2.3 Å

PDB Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7- phosphate
PDB Compounds: (B:) Phosphoheptose isomerase

SCOP Domain Sequences for d1x92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x92b_ c.80.1.3 (B:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]}
ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
laihclcdlidrqlfgs

SCOP Domain Coordinates for d1x92b_:

Click to download the PDB-style file with coordinates for d1x92b_.
(The format of our PDB-style files is described here.)

Timeline for d1x92b_: