Lineage for d1x8da1 (1x8d A:1-104)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557000Family d.58.4.21: YiiL-like [160298] (1 protein)
    Pfam PF05336; DUF718
  6. 2557001Protein L-rhamnose mutarotase YiiL [160299] (1 species)
  7. 2557002Species Escherichia coli [TaxId:562] [160300] (1 PDB entry)
    Uniprot P32156 1-104
  8. 2557003Domain d1x8da1: 1x8d A:1-104 [145855]
    complexed with rns

Details for d1x8da1

PDB Entry: 1x8d (more details), 1.8 Å

PDB Description: crystal structure of e. coli yiil protein containing l-rhamnose
PDB Compounds: (A:) Hypothetical protein yiiL

SCOPe Domain Sequences for d1x8da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8da1 d.58.4.21 (A:1-104) L-rhamnose mutarotase YiiL {Escherichia coli [TaxId: 562]}
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

SCOPe Domain Coordinates for d1x8da1:

Click to download the PDB-style file with coordinates for d1x8da1.
(The format of our PDB-style files is described here.)

Timeline for d1x8da1: