![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.21: YiiL-like [160298] (1 protein) Pfam PF05336; DUF718 |
![]() | Protein L-rhamnose mutarotase YiiL [160299] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [160300] (1 PDB entry) Uniprot P32156 1-104 |
![]() | Domain d1x8da1: 1x8d A:1-104 [145855] complexed with rns |
PDB Entry: 1x8d (more details), 1.8 Å
SCOPe Domain Sequences for d1x8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x8da1 d.58.4.21 (A:1-104) L-rhamnose mutarotase YiiL {Escherichia coli [TaxId: 562]} mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp
Timeline for d1x8da1: